PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004039.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 331aa    MW: 37346.4 Da    PI: 4.7728
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004039.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK60.92.2e-19189231547
                   RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhR 47 
                              + +e++skyF++pi  AAkeL v+ T+LK +CR++GI  WP+R
  Itr_sc004039.1_g00002.1 189 VVVEMISKYFHMPIYRAAKELRVGYTILKERCRELGIFKWPYR 231
                              56799************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.879168256IPR003035RWP-RK domain
PfamPF020422.9E-16191231IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MANQAYFPDQ FSYTTYDIAK YSLWDETSYP VSSSSFPNKI VDPSSDITEY SFFDELVDPT  60
PSSSLPNHIS YPISDVIGYP LLIDVADAAP ASFFPSQISY TSSDISKYPL WDQQHGISTF  120
GNGSLPNIPF DPFLGIEHNM GGLLEATAMN YLSTKENHMA STSGILVQEN TFPVASNASV  180
GGNMTTDYVV VEMISKYFHM PIYRAAKELR VGYTILKERC RELGIFKWPY RHNIENDPDI  240
KEAMKELKSR REMLLRDPNL KLNPAEIRLR DSCTRKIKYR EMMSLLHSPT LPIHPLHIPP  300
LIVDPALPLT VDPPSLATEE DESFKLLVDG F
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-17RWP-RK domain-containing protein